DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT1G60680

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_176267.3 Gene:AT1G60680 / 842362 AraportID:AT1G60680 Length:346 Species:Arabidopsis thaliana


Alignment Length:352 Identity:87/352 - (24%)
Similarity:144/352 - (40%) Gaps:78/352 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLG------TYTSLGGDCERATL--HAIDVGYRHIDTAYFY---ENENEVGAAVQR 64
            :.|.::.:.|||      .|.:...:.:...|  |||:.|....||:..|   .||..:|.|:: 
plant    14 SQGLEVSAQGLGCMALSARYGAPKPETDAIALLHHAINSGVTFFDTSDMYGPETNELLLGKALK- 77

  Fly    65 KIAEGVIKREDIHITTKLWCHFHE---------PKRVEYACRKTLQNFGLQYVDLYLMHWPYSYV 120
               :||  :|.:.:.||......|         |:.|..||..:|:...:..:|||..|      
plant    78 ---DGV--KEKVELATKFGFFIVEGEISEVRGDPEYVRAACEASLKRLDIACIDLYYQH------ 131

  Fly   121 YRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIH 185
                    ..|.:..:|:       |.||::||||.|..|.||:|..::..:.|..|...|..:.
plant   132 --------RIDTRVPIEI-------TMRELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQ 181

  Fly   186 NQIECHPALNQKKLIALCKKNDIVVTAYCPLGR------PNPAE--------KT----------P 226
            .:........::.:|.:|::..|.:.||.||||      |..||        ||          .
plant   182 IEWSLWSRDAEEDIIPICRELGIGIVAYSPLGRGFLAAGPKLAENLENDDFRKTLPRFQQENVDH 246

  Fly   227 NYIYDAKVQAIGDKYKKSTAQVVLRYLIEIG--TIPLPKSSNPKRIEENFQIFDFQLDAEDHAIL 289
            |.|...||.|:.:|...:.||:.|.::...|  ..|:|.::..:.:.:|.:....:|..|:.:.|
plant   247 NKILFEKVSAMAEKKGCTPAQLALAWVHHQGDDVCPIPGTTKIENLNQNIRALSVKLTPEEISEL 311

  Fly   290 DSYN-----TGERLIPMTHAIKSKNYP 311
            ||..     .|||.:......|:.|.|
plant   312 DSLAKPESVKGERYMASMSTFKNSNTP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 84/343 (24%)
Tas 11..290 CDD:223739 78/324 (24%)
AT1G60680NP_176267.3 Tas 11..323 CDD:223739 81/335 (24%)
Aldo_ket_red 11..314 CDD:119408 80/326 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.