DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT1G59960

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_176204.1 Gene:AT1G59960 / 842290 AraportID:AT1G59960 Length:326 Species:Arabidopsis thaliana


Alignment Length:277 Identity:99/277 - (35%)
Similarity:151/277 - (54%) Gaps:21/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGLGTYTSLGGD---CERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIK-REDIHIT 79
            :|.||..|...:   .:...:.||.:||||.||:..|:.|..:|.|:...::.|::: |.:..:|
plant    24 LGFGTAASPLPEPTMLKETVIEAIKLGYRHFDTSPRYQTEEPIGEALAEAVSLGLVRSRSEFFVT 88

  Fly    80 TKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYS-----YVYRGD-NEMMPTDAKGEVEL 138
            |||||.......|..|.:::|:|..|.|:|||::|||.|     |.:..| ::.||         
plant    89 TKLWCADAHGGLVVPAIKRSLKNLKLDYLDLYIIHWPVSSKPGKYKFPIDEDDFMP--------- 144

  Fly   139 NDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALC 203
              :|:...|.|||:...|||.|.||||||:.::|..:|:...|.|..||:|..|...|:||..||
plant   145 --MDFEVVWSEMEECQRLGLAKCIGVSNFSCKKLQHILSIATIPPSVNQVEMSPIWQQRKLRELC 207

  Fly   204 KKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSNPK 268
            :.||||||||..||.......||..:....::.|.:..:|:.|||.:|:..|.|...:.||...:
plant   208 RSNDIVVTAYSVLGSRGAFWGTPKIMESDVLKEIAEAKEKTVAQVSMRWAYEQGVSMVVKSFTKE 272

  Fly   269 RIEENFQIFDFQLDAED 285
            |:|||.:|||:.|..::
plant   273 RLEENLKIFDWSLTEDE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 99/277 (36%)
Tas 11..290 CDD:223739 99/277 (36%)
AT1G59960NP_176204.1 AKR_AKR4A_4B 18..299 CDD:381350 99/277 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.