DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT1G59950

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_176203.1 Gene:AT1G59950 / 842289 AraportID:AT1G59950 Length:320 Species:Arabidopsis thaliana


Alignment Length:288 Identity:102/288 - (35%)
Similarity:153/288 - (53%) Gaps:15/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGLGTYTSLGGD---CERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIK-REDIHIT 79
            :.|||..|...:   .:|..|.||.:||||.||:..|:.|..:|.|:...::.|:|: |.::.:|
plant    18 LALGTAASPPPEPIVLKRTVLEAIKLGYRHFDTSPRYQTEEPLGEALAEAVSLGLIQSRSELFVT 82

  Fly    80 TKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELND---I 141
            :||||.......|..|.:::|:...|.|:||||:|||.|        ..|...|..:|.:|   :
plant    83 SKLWCADAHGGLVVPAIQRSLETLKLDYLDLYLIHWPVS--------SKPGKYKFPIEEDDFLPM 139

  Fly   142 DYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALCKKN 206
            ||...|.|||:...||:.|.||||||:.::|..:|:..||.|..||:|..|...|:||..|||..
plant   140 DYETVWSEMEECQRLGVAKCIGVSNFSCKKLQHILSIAKIPPSVNQVEMSPVWQQRKLRELCKSK 204

  Fly   207 DIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSNPKRIE 271
            .||||||..||.......|...:....::.|.:...|:.|||.:|:..|.|...:.||....|:|
plant   205 GIVVTAYSVLGSRGAFWGTHKIMESDVLKEIAEAKGKTVAQVSMRWAYEEGVSMVVKSFRKDRLE 269

  Fly   272 ENFQIFDFQLDAEDHAILDSYNTGERLI 299
            ||.:|||:.|..|:...:.:..:..|::
plant   270 ENLKIFDWSLTEEEKQRISTEISQSRIV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 102/288 (35%)
Tas 11..290 CDD:223739 101/277 (36%)
AT1G59950NP_176203.1 AKR_AKR4A_4B 12..293 CDD:381350 101/282 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.