DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and KAB1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_171963.1 Gene:KAB1 / 839450 AraportID:AT1G04690 Length:328 Species:Arabidopsis thaliana


Alignment Length:329 Identity:65/329 - (19%)
Similarity:122/329 - (37%) Gaps:99/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NGTQIQSIGLGTYTSLGGDCERATLHAI-----DVGYRHIDTAYFYEN---ENEVGAAVQRKIAE 68
            :|.::.::..|.:.:.|...:.....:|     |.|....|.|..|.|   |..:|.|::    |
plant     9 SGLKVSTLSFGAWVTFGNQLDVKEAKSILQCCRDHGVNFFDNAEVYANGRAEEIMGQAIR----E 69

  Fly    69 GVIKREDIHITTKLWCHFHEP-------KRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNE 126
            ...:|.||.|:||::.....|       |.:....:.:|:...:.|||:...|.|          
plant    70 LGWRRSDIVISTKIFWGGPGPNDKGLSRKHIVEGTKASLKRLDMDYVDVLYCHRP---------- 124

  Fly   127 MMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTR---------LLANCKIK 182
                ||...:|       :|.|.|..:::.|.....|.|.::::|:|.         |:.....:
plant   125 ----DASTPIE-------ETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGAADRLDLVGPIVEQ 178

  Fly   183 PIHNQIECHPALNQKKLIALCKKNDIVVTAYCPL------GRPN----PAEK---TPNY------ 228
            |.:|....|..  :.:.:.|...:.|.:|.:.||      |:.|    |::.   ..||      
plant   179 PEYNMFARHKV--ETEFLPLYTNHGIGLTTWSPLASGVLTGKYNKGAIPSDSRFALENYKNLANR 241

  Fly   229 -IYD------AKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSNP------------KRIEENF 274
             :.|      :.::.|.|:...:.||:.:.:.          :|||            .:|:||.
plant   242 SLVDDVLRKVSGLKPIADELGVTLAQLAIAWC----------ASNPNVSSVITGATRESQIQENM 296

  Fly   275 QIFD 278
            :..|
plant   297 KAVD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 65/329 (20%)
Tas 11..290 CDD:223739 65/329 (20%)
KAB1NP_171963.1 AKR_AKR6C1_2 1..316 CDD:381369 65/329 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.