DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT1G06690

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_563770.1 Gene:AT1G06690 / 837179 AraportID:AT1G06690 Length:377 Species:Arabidopsis thaliana


Alignment Length:273 Identity:66/273 - (24%)
Similarity:109/273 - (39%) Gaps:62/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKRE-------DIHITTKL----WCHFHEPKR 91
            ::|.|....|||..|.::..:||.....:....|:..       ::.:.||.    |....|  .
plant    94 SLDNGIDFFDTAEVYGSKFSLGAISSETLLGRFIRERKERYPGAEVSVATKFAALPWRFGRE--S 156

  Fly    92 VEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVEL 156
            |..|.:.:|....|..||||.:|||..:...|                   |||   .:...||.
plant   157 VVTALKDSLSRLELSSVDLYQLHWPGLWGNEG-------------------YLD---GLGDAVEQ 199

  Fly   157 GLTKSIGVSNFNSEQLTRLLANCKIKPI---HNQIE---CHPALNQKKLIALCKKNDIVVTAYCP 215
            ||.|::||||::.::|.......|.:.|   .||:.   .:.|..|..:.|.|.:..:.:.||.|
plant   200 GLVKAVGVSNYSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSP 264

  Fly   216 LGR---------PNPAEKTPNYIYDA-----------KVQAIGDKYKKSTAQVVLRYLIEIG-TI 259
            :.:         .||.......||..           :::.||:.|.|:..|:.|.:|:..| .|
plant   265 IAQGALTGKYTPENPPSGPRGRIYTREFLTKLQPLLNRIKQIGENYSKTPTQIALNWLVAQGNVI 329

  Fly   260 PLPKSSNPKRIEE 272
            |:|.:.|.::.:|
plant   330 PIPGAKNAEQAKE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 66/273 (24%)
Tas 11..290 CDD:223739 66/273 (24%)
AT1G06690NP_563770.1 AKR_AtPLR-like 57..360 CDD:381319 66/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.