DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT5G62420

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_201048.1 Gene:AT5G62420 / 836363 AraportID:AT5G62420 Length:316 Species:Arabidopsis thaliana


Alignment Length:287 Identity:102/287 - (35%)
Similarity:163/287 - (56%) Gaps:22/287 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GTQIQSIGLGTYTSLGGDCER--------ATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEG 69
            |..|..:|:|||      |.:        |...||.:||||.|||..|.:|..:|.|:.:.|:.|
plant    11 GETIPLLGMGTY------CPQKDRESTISAVHQAIKIGYRHFDTAKIYGSEEALGTALGQAISYG 69

  Fly    70 VIKREDIHITTKLW-CHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAK 133
            .::|:|:.:|:||| ...|:|..   |..:||:..||.|:|.||:|||.. :..|.:|.:|.:.:
plant    70 TVQRDDLFVTSKLWSSDHHDPIS---ALIQTLKTMGLDYLDNYLVHWPIK-LKPGVSEPIPKEDE 130

  Fly   134 GEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKK 198
            .|   .|:...:||:.||:.:|:||.:|||||||:|:::..||....:.|..||:|.||...|:|
plant   131 FE---KDLGIEETWQGMERCLEMGLCRSIGVSNFSSKKIFDLLDFASVSPSVNQVEMHPLWRQRK 192

  Fly   199 LIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPK 263
            |..:|::|:|.|:.|.|||.|.....:...|....:::|..|:..:.|||.||:.:..|...:.|
plant   193 LRKVCEENNIHVSGYSPLGGPGNCWGSTAVIEHPIIKSIALKHNATPAQVALRWGMSKGASVIVK 257

  Fly   264 SSNPKRIEENFQIFDFQLDAEDHAILD 290
            |.|..|:.||.:..:.:||.:|.:::|
plant   258 SFNGARMIENKRALEIKLDDQDLSLID 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 102/287 (36%)
Tas 11..290 CDD:223739 101/285 (35%)
AT5G62420NP_201048.1 AKR_AKR4A_4B 10..288 CDD:381350 102/287 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.