DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AKR1E2

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_011518017.1 Gene:AKR1E2 / 83592 HGNCID:23437 Length:341 Species:Homo sapiens


Alignment Length:317 Identity:137/317 - (43%)
Similarity:177/317 - (55%) Gaps:42/317 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKREDIHITTKLWCHFHEPKRVE 93
            |....|...|||.||||.|.||||.||.||||.::.||.||.::|||:.|.|||||..|:...||
Human    38 GKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVE 102

  Fly    94 YACRKTLQNFGLQYVDLYLMHWPYSYV------YRGDNEM-----------MPTDAKGEVELNDI 141
            .||||:|:...|.|:||||:|||..:.      ....:|:           :|.|....|..:|.
Human   103 TACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDT 167

  Fly   142 DYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKLIALCK 204
            |:||||..||.||..||.|:|||||||.|||.|||  ...:.||:.|||||||.|.||.||:.|:
Human   168 DFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQ 232

  Fly   205 KNDIVVTAYCPLGR--------PNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPL 261
            ..|:.||||.|||.        .||.           ::.|..::.||.||:::|:.|:...|.:
Human   233 SRDVSVTAYRPLGGSCEGVDLIDNPV-----------IKRIAKEHGKSPAQILIRFQIQRNVIVI 286

  Fly   262 PKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERL--IPMTHAIKSKNYPFNIEF 316
            |.|..|..|:||.|:|||:|...|...:.|.|...||  .|:|.  ..|:|||:||:
Human   287 PGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITK--NHKDYPFHIEY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 131/303 (43%)
Tas 11..290 CDD:223739 125/287 (44%)
AKR1E2XP_011518017.1 ARA1 34..322 CDD:223729 127/294 (43%)
Tas 42..314 CDD:223739 124/282 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.