DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT5G01670

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_850750.1 Gene:AT5G01670 / 831701 AraportID:AT5G01670 Length:349 Species:Arabidopsis thaliana


Alignment Length:316 Identity:111/316 - (35%)
Similarity:171/316 - (54%) Gaps:39/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NGTQIQSIGLGTYTSLGGDCERATLHAI-DVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKRED 75
            :|.:|.::||||:.| |.....|.:.|| :.||||||||:.|.::.|||..::|.:..| ::|.|
plant    20 SGHKIPAVGLGTWRS-GSQAAHAVVTAIVEGGYRHIDTAWEYGDQREVGQGIKRAMHAG-LERRD 82

  Fly    76 IHITTKLW---------------------------CHFHEPKRVEYACRKTLQNFGLQYVDLYLM 113
            :.:|:|||                           |....|:||..|.:.||:...|:|:||||:
plant    83 LFVTSKLWYTLILRKMINLSSPLMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLDLYLI 147

  Fly   114 HWPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLAN 178
            |||   :...:....|..| |:|  .|.|....|||||.|.:..|.::|||.||...:|.:||..
plant   148 HWP---IRLREGASKPPKA-GDV--LDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGF 206

  Fly   179 CKIKPIHNQIECHPALNQKKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKK 243
            .::.|...|:|.||.....:::..||||:|.||||.|||   ..|...:.|:|..|..|..|..|
plant   207 AELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLG---SQEGGRDLIHDQTVDRIAKKLNK 268

  Fly   244 STAQVVLRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLI 299
            :..|:::::.::.||..:|||.||:||:||.::||:.:..:|...|:|....:|:|
plant   269 TPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 111/316 (35%)
Tas 11..290 CDD:223739 107/305 (35%)
AT5G01670NP_850750.1 ARA1 11..317 CDD:223729 108/307 (35%)
Tas 13..317 CDD:223739 108/307 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.