DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and ChlAKR

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001031505.1 Gene:ChlAKR / 818354 AraportID:AT2G37770 Length:315 Species:Arabidopsis thaliana


Alignment Length:281 Identity:111/281 - (39%)
Similarity:171/281 - (60%) Gaps:7/281 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRK 65
            |::.|.:.|.|.|.:..|:||||:.:..|....|...|:.:||||||.|..|.||.|:||.:::.
plant     1 MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKL 65

  Fly    66 IAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPT 130
            ..:.|:||||:.||:||||..|:|:.|..|..:||::..|:||||||:||| :.:.:|...:.|.
plant    66 FEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWP-ARIKKGSVGIKPE 129

  Fly   131 DAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALN 195
            :      |..:|...||:.||.|.:.|..::||||||::::|..||...::.|..||:||||:..
plant   130 N------LLPVDIPSTWKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWR 188

  Fly   196 QKKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIP 260
            |.||...||...:.::||.|||.|.......:.:.:..:..:.:|..||.|||.||:.:::|...
plant   189 QTKLQEFCKSKGVHLSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSV 253

  Fly   261 LPKSSNPKRIEENFQIFDFQL 281
            ||||:|..||:|||.:||:.:
plant   254 LPKSTNEGRIKENFNVFDWSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 109/276 (39%)
Tas 11..290 CDD:223739 108/271 (40%)
ChlAKRNP_001031505.1 AKR_AKR4C1-15 6..291 CDD:381351 109/276 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.