DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AKR4C8

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_565871.1 Gene:AKR4C8 / 818353 AraportID:AT2G37760 Length:311 Species:Arabidopsis thaliana


Alignment Length:281 Identity:111/281 - (39%)
Similarity:165/281 - (58%) Gaps:11/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRK 65
            |::.|.:.:.|.|.::..:|||||..:....|:    ||.:||||||.|..|.||.|:|..:::.
plant     1 MAAPIRFFELNTGAKLPCVGLGTYAMVATAIEQ----AIKIGYRHIDCASIYGNEKEIGGVLKKL 61

  Fly    66 IAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPT 130
            |.:|.:|||::.||:|||.:.|.|:.|..|..||||:..:.||||||:|||.|.   ....:|||
plant    62 IGDGFVKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASL---KKESLMPT 123

  Fly   131 DAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALN 195
            ...    |...|...||:.||.|.:.|..::||||||:|::||.||...::.|..||:||||...
plant   124 PEM----LTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQ 184

  Fly   196 QKKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIP 260
            |:.|..|||...:.::.|.|||..:..|.....:.:..|..:.:|..|:||||.||:.::.|...
plant   185 QQGLHELCKSKGVHLSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGLQTGHSV 249

  Fly   261 LPKSSNPKRIEENFQIFDFQL 281
            |||||:..|::||..:||:.:
plant   250 LPKSSSGARLKENLDVFDWSI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 109/276 (39%)
Tas 11..290 CDD:223739 109/271 (40%)
AKR4C8NP_565871.1 AKR_AKR4C1-15 6..288 CDD:381351 109/276 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.