DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT2G21260

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_179722.1 Gene:AT2G21260 / 816665 AraportID:AT2G21260 Length:309 Species:Arabidopsis thaliana


Alignment Length:301 Identity:121/301 - (40%)
Similarity:176/301 - (58%) Gaps:17/301 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKRED 75
            |:|.::..||||.:.....:.....:.||.:||||:|.|..|:||.|||.|:......|::||||
plant     6 NSGFKMPIIGLGVWRMEKEELRDLIIDAIKIGYRHLDCAANYKNEAEVGEALTEAFTTGLVKRED 70

  Fly    76 IHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTD-AKGEVELN 139
            :.||||||...|  ..|..||:.:|:...|.|:||:|:|.|.:..:.|   :..|| |.|:..:.
plant    71 LFITTKLWSSDH--GHVIEACKDSLKKLQLDYLDLFLVHIPIATKHTG---IGTTDSALGDDGVL 130

  Fly   140 DIDYL----DTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLI 200
            |||..    .||.:|||||.:||.:|||:||::.......||..||||..||||.||...:..|:
plant   131 DIDTTISLETTWHDMEKLVSMGLVRSIGISNYDVFLTRDCLAYSKIKPAVNQIETHPYFQRDSLV 195

  Fly   201 ALCKKNDIVVTAYCPLGRPNPAEK---TPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLP 262
            ..|:|:.|.|||:.|||......:   |.:.:.|..::.:.:|||::.||:|||:.|:..|:.:|
plant   196 KFCQKHGICVTAHTPLGGATANAEWFGTVSCLDDPVLKDVAEKYKQTVAQIVLRWGIQRNTVVIP 260

  Fly   263 KSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTH 303
            |:|.|:|:|||||:|||||..||..::.|.....|    ||
plant   261 KTSKPERLEENFQVFDFQLSKEDMEVIKSMERNYR----TH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 121/301 (40%)
Tas 11..290 CDD:223739 117/286 (41%)
AT2G21260NP_179722.1 AKR_AKR2A1-2 1..308 CDD:381338 121/301 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.