DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and akr1c3

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001072181.1 Gene:akr1c3 / 779627 XenbaseID:XB-GENE-5821909 Length:324 Species:Xenopus tropicalis


Alignment Length:325 Identity:136/325 - (41%)
Similarity:189/325 - (58%) Gaps:17/325 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIPYVKHNNGTQIQSIGLGTYT------SLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAV 62
            |..||:.|:|.::..||.|||.      ||   .|..|..||||||||||.|:.|.||.|||.|:
 Frog     5 KDSYVELNDGHKMPVIGFGTYAPPKFPKSL---AEEGTKVAIDVGYRHIDCAFLYGNEEEVGRAI 66

  Fly    63 QRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEM 127
            :.|||:|.:||||:..|.|||...|.|:||..|..|:|::..|.|:||:::|.|..  ::..:::
 Frog    67 RAKIADGTVKREDVFYTGKLWSTSHTPERVRPALEKSLKDLQLDYMDLFIIHMPME--FKPGDDL 129

  Fly   128 MPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIEC 190
            .|.|..|:...::.|..|||:.:||..:.||.:||||||||.:||..:|  ...|.||:.||:||
 Frog   130 FPADENGKFIYHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVEC 194

  Fly   191 HPALNQKKLIALCKKNDIVVTAYCPLGRPNPAE----KTPNYIYDAKVQAIGDKYKKSTAQVVLR 251
            |..|||.||:..||..|||:..|..||......    .||..:.|..:..|..|:.::.|||.:|
 Frog   195 HVYLNQSKLLEFCKSKDIVLVGYSVLGSSRDERWIEASTPVLLEDPALTEIAKKHNRTPAQVAMR 259

  Fly   252 YLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            |.::.|.:.|.||..|.||::|||:|||||||||...:|..|...|.|..:.......||::.|:
 Frog   260 YHLQRGVVVLAKSFTPARIQQNFQVFDFQLDAEDMRSIDGLNRNMRYIDTSRWSDHPKYPYSEEY 324

  Fly   317  316
             Frog   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 132/309 (43%)
Tas 11..290 CDD:223739 126/290 (43%)
akr1c3NP_001072181.1 AKR_AKR1C1-35 8..308 CDD:381334 131/304 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.