DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c21

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_084177.2 Gene:Akr1c21 / 77337 MGIID:1924587 Length:323 Species:Mus musculus


Alignment Length:327 Identity:128/327 - (39%)
Similarity:183/327 - (55%) Gaps:15/327 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYTSLGGDCERA-----TLHAIDVGYRHIDTAYFYENENEVGA 60
            |:||...|..|:|..|..:|.||...|  :|.::     |..|||.|:.|.|:|..|..|:.||.
Mouse     1 MNSKCHCVILNDGNFIPVLGFGTALPL--ECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGE 63

  Fly    61 AVQRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDN 125
            |::.|||:|.::||||..|:|:||....|:.|..:..::||.....||||||:|:|.:  .:...
Mouse    64 AIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMA--LKPGE 126

  Fly   126 EMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQI 188
            |..|.|..|::..:.:|...||..|||..:.||||||||||||..||..:|  ...|.||:.||:
Mouse   127 ENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPVCNQV 191

  Fly   189 ECHPALNQKKLIALCKKNDIVVTAYCPLGRPNPA----EKTPNYIYDAKVQAIGDKYKKSTAQVV 249
            ||||.|||.||:..||..|||:.||..||.....    :.:|..:.:..:.::..||.::.|.:.
Mouse   192 ECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSMAKKYNRTPALIA 256

  Fly   250 LRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNI 314
            |||.::.|.:.|..|...:||:||.|:|:|||.:||..:||..|...|.||........|:||..
Mouse   257 LRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPFLD 321

  Fly   315 EF 316
            |:
Mouse   322 EY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 121/308 (39%)
Tas 11..290 CDD:223739 114/289 (39%)
Akr1c21NP_084177.2 AKR_AKR1C1-35 6..308 CDD:381334 120/305 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.