DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1b10

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_765986.3 Gene:Akr1b10 / 67861 MGIID:1915111 Length:316 Species:Mus musculus


Alignment Length:309 Identity:137/309 - (44%)
Similarity:191/309 - (61%) Gaps:7/309 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKREDIH 77
            |.::..:||||:.|.......|...|||.||||||.||.|:||:|||.|:|.||.|..:||||:.
Mouse    10 GAKMPIVGLGTWKSPPAKVREAVKVAIDAGYRHIDCAYVYQNESEVGEAIQEKIQEKAVKREDLF 74

  Fly    78 ITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDID 142
            |.:|||..|.|...|:.|.:.||.:..|.|:||||:|||..  ::..|..:|||.||.:..:...
Mouse    75 IVSKLWSTFFEKSLVKKAFQNTLSDLKLDYLDLYLIHWPQG--FQSGNVFLPTDDKGSILSSKYT 137

  Fly   143 YLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKLIALCKK 205
            :||.|..||:||:.||.|::||||||..|:.|||  ...|.||:.||:||||.|.|:|||..|..
Mouse   138 FLDAWEAMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHS 202

  Fly   206 NDIVVTAYCPLG---RPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSNP 267
            ..|.:|||.|||   ||:...:.|..:...|::.|..|:|::.|||::|:.||...:.:|||..|
Mouse   203 KGITITAYSPLGSPDRPSAKPEDPLLLEIPKIKEIAAKHKRTAAQVLIRFHIERNVVVIPKSVTP 267

  Fly   268 KRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            .||:||.|:|||||..||.|.:.|:|...|...:..|..::::||:.|:
Mouse   268 SRIQENIQVFDFQLSEEDMAAILSFNRNWRACGLFAASHNEDFPFHAEY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 133/295 (45%)
Tas 11..290 CDD:223739 130/281 (46%)
Akr1b10NP_765986.3 ARA1 1..297 CDD:223729 132/288 (46%)
Tas 9..289 CDD:223739 130/280 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.