DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c12

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_038805.2 Gene:Akr1c12 / 622402 MGIID:1351661 Length:323 Species:Mus musculus


Alignment Length:330 Identity:145/330 - (43%)
Similarity:191/330 - (57%) Gaps:21/330 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTY--------TSLGGDCERATLHAIDVGYRHIDTAYFYENENE 57
            ||||..|||.|:|..|.::|.|||        .||...|     .|:||||||:||||.|:.|.|
Mouse     1 MSSKQHYVKLNDGHLIPALGFGTYKPKEVPKSKSLEAAC-----LALDVGYRHVDTAYAYQVEEE 60

  Fly    58 VGAAVQRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYR 122
            :|.|:|.||..||:||||:.|||||||....|:.|:.|..|:|::..|.||||||:|:|.. :..
Mouse    61 IGQAIQSKIKAGVVKREDLFITTKLWCGCFRPELVKPALEKSLKSLQLDYVDLYLIHYPVP-MKP 124

  Fly   123 GDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIH 185
            |||| .|.|..|:..|:.:|:.|||..:|:..:.||.|||||||||..||.|:|  ...|.||:.
Mouse   125 GDNE-SPLDENGKFLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVC 188

  Fly   186 NQIECHPALNQKKLIALCKKNDIVVTAYCPLGRPNPAE----KTPNYIYDAKVQAIGDKYKKSTA 246
            ||:|||..|||.||:..||..|||:.||..||.....|    .:|..:.|..:..:..:.|:|.|
Mouse   189 NQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKRNKRSPA 253

  Fly   247 QVVLRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYP 311
            .:.||||.:.|.:||.:|.....:.||.|:|:|||..||...||..|...|.:|.........||
Mouse   254 LIALRYLFQRGIVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLPAEFLADHPEYP 318

  Fly   312 FNIEF 316
            |:.|:
Mouse   319 FSEEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 137/311 (44%)
Tas 11..290 CDD:223739 129/292 (44%)
Akr1c12NP_038805.2 Tas 6..297 CDD:223739 132/297 (44%)
ARA1 7..307 CDD:223729 136/306 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.