DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1a1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_067448.1 Gene:Akr1a1 / 58810 MGIID:1929955 Length:325 Species:Mus musculus


Alignment Length:317 Identity:130/317 - (41%)
Similarity:189/317 - (59%) Gaps:17/317 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEG-VIKRE 74
            :.|.::..|||||:.|..|..:.|..||:..||||||.|..|.||.|:|.|::..:..| .:.||
Mouse     9 HTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPRE 73

  Fly    75 DIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELN 139
            ::.:|:|||...|.|:.||.|.||||.:..|:|:|||||||||:: .||||. .|.:|.|.|..:
Mouse    74 ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAF-ERGDNP-FPKNADGTVRYD 136

  Fly   140 DIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALCK 204
            ...|.:||:.:|.||..||.|::|:|||||.|:..:|:...::|...|:||||.|.|.:|||.|.
Mouse   137 STHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCH 201

  Fly   205 KNDIVVTAYCPLGRPNPAEKTPN---YIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSN 266
            ...:.||||.|||..:.|.:.|:   .:.:..|.|:.:|:.:|.||::||:.::...|.:|||.|
Mouse   202 ARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSIN 266

  Fly   267 PKRIEENFQIFDFQLDAEDHAILDSYNTGER-LIPMTHAIKSKN---------YPFN 313
            |.||.:|.|:|||....|:...||:.|...| ::||. .:..|.         ||||
Mouse   267 PSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMI-TVDGKRVPRDAGHPLYPFN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 125/297 (42%)
Tas 11..290 CDD:223739 119/282 (42%)
Akr1a1NP_067448.1 ARA1 1..303 CDD:223729 124/295 (42%)
Tas 9..291 CDD:223739 120/283 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.