DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and XB5731323

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_031755921.1 Gene:XB5731323 / 548351 XenbaseID:XB-GENE-5731324 Length:284 Species:Xenopus tropicalis


Alignment Length:304 Identity:113/304 - (37%)
Similarity:169/304 - (55%) Gaps:27/304 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKIPYVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDV-GYRHIDTAYFYENENEVGAAVQRKI 66
            ||||.|...:|..|..:||| .:.:||.|..|.|:|:.. |.||||||..|.||..||.|    |
 Frog     4 SKIPTVPLASGQHIPLLGLG-MSHVGGYCHNALLYALTTCGIRHIDTAKRYGNEVMVGKA----I 63

  Fly    67 AEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTD 131
            .|..:|||::.:|||||...:..:....||..:.:..|:.|:||||||||        :..:|..
 Frog    64 CESGVKREELWLTTKLWPGDYGYENAIQACLDSCKRLGVDYLDLYLMHWP--------DAQIPGK 120

  Fly   132 AKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQ 196
            :..|..      .:||:.:|:|.|.|:.:|||||||....|.:|..:|.:.|..||:|.||....
 Frog   121 SAREAR------AETWQALEELNERGICRSIGVSNFLIHHLDQLKEDCNMVPHLNQVEYHPFQRP 179

  Fly   197 KKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPL 261
            ::|:..|::|:||...||||.: ..|...|      .:|.|...|.|:.|||.:|:.|:.|.:.:
 Frog   180 QELVDYCRRNNIVFEGYCPLAK-GQALNHP------VIQKIAKNYGKTPAQVCIRWSIQNGIVTI 237

  Fly   262 PKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAI 305
            |||:..:||:||.::|:|||:.|....:.|.|:..:||.:|:.:
 Frog   238 PKSTKEERIQENCEVFNFQLEQEHMDCITSLNSNRKLIHLTYPL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 110/298 (37%)
Tas 11..290 CDD:223739 103/279 (37%)
XB5731323XP_031755921.1 AKR_CeZK1290-like 5..268 CDD:381361 107/288 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.