DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and akr1c4

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_031753743.1 Gene:akr1c4 / 496490 XenbaseID:XB-GENE-5895888 Length:328 Species:Xenopus tropicalis


Alignment Length:321 Identity:129/321 - (40%)
Similarity:185/321 - (57%) Gaps:27/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSL---GGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIK 72
            ::|..|..:|||||.|.   ..|...||..|||:||||||.||.|.||.::|.|::.|||:|.:|
 Frog    20 HDGNAIPVMGLGTYASAEVPKSDGTEATKLAIDLGYRHIDCAYIYGNEVQIGEAIRSKIADGTVK 84

  Fly    73 REDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGE-- 135
            ||:|..|.||||.|..|..|......:|:...|.|:||::||||:|        :.|:||...  
 Frog    85 REEIFYTGKLWCSFFSPNLVRQGLEASLKALQLDYLDLFIMHWPFS--------VKPSDAHSNQP 141

  Fly   136 VELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLA--NCKIKPIHNQIECHPALNQKK 198
            ::.:|:|:..||..:|...:.||.|||||||||..||.|||:  ..|.||:.||:|.|..|||.|
 Frog   142 LDFDDVDFCLTWEALEGCKDAGLVKSIGVSNFNRRQLERLLSKPGLKYKPVCNQVEYHVYLNQSK 206

  Fly   199 LIALCKKNDIVVTAYCPLGR--------PNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIE 255
            |...||.::||:.||..||.        ||    :|..:.|..::::..||.:|.|:|.:|::::
 Frog   207 LHEYCKCHNIVLVAYSVLGTARDNTWVDPN----SPVLLEDPVLRSVAAKYNRSPAEVAMRFILQ 267

  Fly   256 IGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            .|.:.|.||.||.|:::|..:|:|:|..||..:||..|...|....|...:...|||:.|:
 Frog   268 KGAVVLAKSFNPTRLKQNLGVFEFELKPEDMEMLDGLNRNLRYAQFTVMKQHPEYPFHDEY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 125/307 (41%)
Tas 11..290 CDD:223739 120/293 (41%)
akr1c4XP_031753743.1 AKR_SF 15..313 CDD:412396 124/304 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.