DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and akr7a2

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001034821.1 Gene:akr7a2 / 447982 XenbaseID:XB-GENE-996153 Length:348 Species:Xenopus tropicalis


Alignment Length:150 Identity:33/150 - (22%)
Similarity:56/150 - (37%) Gaps:46/150 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GYRHIDTAYFYENENEVGAAVQRKIAEGVIKR--------EDIHITTKL--W-CHFHEPKRVEYA 95
            |:..:|||..|              |||..:|        ..:.:.||.  | .:..:|:.|...
 Frog    61 GHEELDTALMY--------------AEGETERILGRMELGSQVKMATKANPWGGNTLKPESVRQQ 111

  Fly    96 CRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTK 160
            ..|:||......|.|:.:|.|              |.:..||       :|....::|.:.|..|
 Frog   112 LEKSLQQLQTPSVHLFYLHAP--------------DHQTPVE-------ETLGACQQLYQEGKFK 155

  Fly   161 SIGVSNFNSEQLTRLLANCK 180
            .:|:||:.:.::..:...||
 Frog   156 ELGLSNYAAWEVMEIYCICK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 32/149 (21%)
Tas 11..290 CDD:223739 32/149 (21%)
akr7a2NP_001034821.1 Tas 36..344 CDD:223739 32/149 (21%)
Aldo_ket_red 36..335 CDD:119408 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.