DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and akr1a1a

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001003783.1 Gene:akr1a1a / 445326 ZFINID:ZDB-GENE-040808-44 Length:324 Species:Danio rerio


Alignment Length:316 Identity:134/316 - (42%)
Similarity:198/316 - (62%) Gaps:17/316 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEG-VIKRE 74
            :.|.::.::||||:.|..|..::|.|.|:|.||||||.|..|.||.|||.|:..::..| .::|:
Zfish     8 STGQRMPTVGLGTWKSAPGQVKQAVLAALDCGYRHIDCAAAYSNEREVGEALTERLGPGKSLRRD 72

  Fly    75 DIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELN 139
            ||.:|:|||...|.|..||.|||::|.:..|.|:||||:|||.:: .||| |::|....|.::.:
Zfish    73 DIFVTSKLWNTKHHPDDVEEACRRSLSDLRLSYLDLYLIHWPMAF-GRGD-ELIPRHPDGTIQYD 135

  Fly   140 DIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALCK 204
            |..|.|||..|||||:.||.|:||:||||::|:..:|:..|.||:.||:||||.|.|.:|.:.|.
Zfish   136 DTHYRDTWAAMEKLVDQGLAKAIGLSNFNAKQIDDILSIAKHKPVVNQVECHPYLVQAELASHCW 200

  Fly   205 KNDIVVTAYCPLGRPNPAEKTPN---YIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSN 266
            ..::.||||.|||.|:....||.   .:.|.:|..|...|.|:.|||::|:.|:.|.:.:|||..
Zfish   201 SRNLTVTAYSPLGSPDRPWVTPGEALLLDDPRVVGIAKSYNKTPAQVIIRWHIQRGVVCIPKSVT 265

  Fly   267 PKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKS----------KNYPF 312
            |.||::|.::|||:|..||..:::|:|..||.|..| .||.          .::||
Zfish   266 PSRIKQNIEVFDFKLSDEDMRLIESFNRNERFIIPT-VIKDGQKVWRDANHPHFPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 130/296 (44%)
Tas 11..290 CDD:223739 124/282 (44%)
akr1a1aNP_001003783.1 ARA1 1..297 CDD:223729 127/290 (44%)
Tas 14..300 CDD:223739 128/287 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594364
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.620

Return to query results.
Submit another query.