DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c19

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001013807.2 Gene:Akr1c19 / 432720 MGIID:2653678 Length:323 Species:Mus musculus


Alignment Length:325 Identity:140/325 - (43%)
Similarity:192/325 - (59%) Gaps:11/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTY--TSLGGDCERATLH-AIDVGYRHIDTAYFYENENEVGAAV 62
            ||||...||.|:|..|.::|.|||  ..:..:.....:| |::.|:|||||||.|:.||.||.|:
Mouse     1 MSSKQQCVKLNDGNFIPALGFGTYKPEEVNENKPLEAIHLALEAGFRHIDTAYVYQTENHVGQAI 65

  Fly    63 QRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEM 127
            :.|||.|::|||||.:||||||.||.|:.|.....|:|:|..|.|.||||:|:|..  .:...::
Mouse    66 RSKIAAGLVKREDIFLTTKLWCTFHRPELVRSNLEKSLKNLQLDYADLYLIHYPVQ--MKPGEDL 128

  Fly   128 MPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIEC 190
            .|.|..|:...:.:|...||..|||..:.||.||||||||||.||.::|  ...|.||:.||:||
Mouse   129 FPEDEHGKTLFDTVDICATWEAMEKCKDAGLVKSIGVSNFNSRQLEKILNKPGLKYKPVCNQVEC 193

  Fly   191 HPALNQKKLIALCKKNDIVVTAYCPLGRPNPAE----KTPNYIYDAKVQAIGDKYKKSTAQVVLR 251
            |..|||:||:..||..|||:.|||.||...|..    .:|..:.|..:..:..|:|:|.||:.||
Mouse   194 HLYLNQRKLLNYCKSKDIVLVAYCALGSQRPKRWVDPSSPVLLNDPILCDMAKKHKRSPAQIALR 258

  Fly   252 YLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            |.::.|.:.|.:|.....|:||.|:|:|:|.:||..||||.:...|..|.........|||:.||
Mouse   259 YHLQRGIVVLAQSYKENEIKENIQVFEFELPSEDMKILDSLDRNLRYAPAPFGEGHPEYPFSDEF 323

  Fly   317  316
            Mouse   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 131/306 (43%)
Tas 11..290 CDD:223739 124/287 (43%)
Akr1c19NP_001013807.2 ARA1 8..307 CDD:223729 130/300 (43%)
Tas 11..310 CDD:223739 129/300 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134145
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.