DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and CG3397

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster


Alignment Length:372 Identity:77/372 - (20%)
Similarity:139/372 - (37%) Gaps:111/372 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIP--YVK--H--------------NNGTQIQSIGLGTYT-----SLGGDCERATL---HAI 39
            ||..:|  :||  |              :.|.::..|.||..|     |...|.|...|   .||
  Fly     1 MSGSLPATFVKGFHDEEKVRRMEYRQLGSTGLRVSKIALGGATLSKLFSDDFDREEGILTVQEAI 65

  Fly    40 DVGYRHIDTAYFY---ENENEVGAAVQRKIAEGVIKREDIHITTKLWCHFHEPKRV-EYACRKTL 100
            ..|..:||||.||   ::|..:|.|::.      :.||..:|.||:..:..:|..: :|...|..
  Fly    66 RSGINYIDTAPFYGQGKSEELLGQALKD------VPREAYYIATKVARYELDPNNMFDYTAAKAR 124

  Fly   101 QNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDIDYL--------DTWREMEKLVELG 157
            ::                  .:...|::..|....::::|:|..        :|...:|:.|:.|
  Fly   125 ES------------------VKRSLELLQLDRVDVLQVHDVDAAPSLDMVLNETIPVLEEYVQAG 171

  Fly   158 LTKSIGVSNFNSEQLTRLLANC------KIKPIHNQIECHPALNQKKLIALCKKNDIVVTAYCP- 215
            ..:.|||:.::.:    :|..|      :|:.:.|... :..|:...|..:....::.|...|. 
  Fly   172 KARFIGVTAYDVD----VLKECAERGKGRIQVVLNYAR-YTLLDNTLLRHMKAFQEMGVGVVCAA 231

  Fly   216 ------LGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIG------TIPLPKSS--- 265
                  |....|....|.   ..::.|:|    |..|::..:..:|:|      |:.|..::   
  Fly   232 AHSLGLLSNAGPQSWHPG---SPELLAVG----KRGAEICQKRNVELGKLAMYYTMQLDGAATFL 289

  Fly   266 ----NPKRIEENFQ-IFDFQLDAEDHAILD---------SYNTGERL 298
                |.|.:..|.. ||| .|.:.:..:|.         ||:.|..|
  Fly   290 IGIPNRKLLRINLDAIFD-GLTSHEQEVLQYLRENVFTKSYSWGSTL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 75/367 (20%)
Tas 11..290 CDD:223739 66/325 (20%)
CG3397NP_650140.1 Tas 22..304 CDD:223739 62/317 (20%)
Aldo_ket_red 24..322 CDD:294321 67/334 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468234
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.