DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c12

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c12 / 364773 RGDID:1359406 Length:323 Species:Rattus norvegicus


Alignment Length:326 Identity:142/326 - (43%)
Similarity:186/326 - (57%) Gaps:13/326 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTY----TSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAA 61
            ||||:..||.|:|..|.::|.|||    .......|.|.| ||||||||||||..|:.|.|:|.|
  Rat     1 MSSKLHCVKLNDGHFIPALGFGTYKPKEVPKSKSLEAAHL-AIDVGYRHIDTASAYQVEEEIGQA 64

  Fly    62 VQRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNE 126
            :|.||..||:||:|:.|||||||.....:.|..|..|:|:|..|.||||:|:|:|..  .:...:
  Rat    65 IQSKIKAGVVKRKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVP--IKSSVD 127

  Fly   127 MMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIE 189
            ..|.|.||:..|:.:|:.|||..:||..:.||.|||||||||.:||.|||  ...|.||:.||:|
  Rat   128 ESPLDEKGKFLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVE 192

  Fly   190 CHPALNQKKLIALCKKNDIVVTAYCPLGRPNPAE----KTPNYIYDAKVQAIGDKYKKSTAQVVL 250
            ||..|||.||:..||..|||:.||..||.....|    .:|..:.|..:..:..|.|:|.|.:.|
  Rat   193 CHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPILCDVAKKNKRSPALIAL 257

  Fly   251 RYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIE 315
            |||.:.|.:||.:|.....:.||.|:|:|||..||...||..|...|.:..........|||:.|
  Rat   258 RYLFQRGVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLADHPEYPFSEE 322

  Fly   316 F 316
            :
  Rat   323 Y 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 134/307 (44%)
Tas 11..290 CDD:223739 128/288 (44%)
Akr1c12NP_001014262.3 ARA1 8..305 CDD:223729 133/299 (44%)
Tas 16..297 CDD:223739 126/283 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.