DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c15

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:318 Identity:137/318 - (43%)
Similarity:188/318 - (59%) Gaps:11/318 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKHNNGTQIQSIGLGTYTSL---GGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEG 69
            ||.|:|..:..:|.||:.|.   ......||..|||||:||||.||||:||.|||.|::.|:|:|
  Rat     9 VKLNDGNLMPVLGFGTFASKEIPKSKAAEATKVAIDVGFRHIDAAYFYQNEEEVGQALRDKMADG 73

  Fly    70 VIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKG 134
            .:||||:..|||:|..|..|:.|.....::|:..||.||||.::|.|.:  .:...|::|.||.|
  Rat    74 TVKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCIIHIPIA--MKPGEELLPKDANG 136

  Fly   135 EVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQK 197
            :...:.:|..|||..:||..:.||:|||||||||.:||..:|  ...|.||..||:||||.|||.
  Rat   137 KFIFDTVDIRDTWEALEKCKDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCNQVECHPYLNQS 201

  Fly   198 KLIALCKKNDIVVTAYCPLGRPNP----AEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGT 258
            ||:..||..|||:.||..||....    :..:|..:.|..:..|..|:.::..||.|||.::.|.
  Rat   202 KLLEFCKSKDIVLVAYSALGSHRDSSWVSSDSPYLLEDPVLMTIAKKHNQTPGQVALRYQLQRGV 266

  Fly   259 IPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            :.|.||.|.|||:||||:|||:|..||...:||.|...|...|..|:...:|||..|:
  Rat   267 VVLAKSFNEKRIKENFQVFDFELTPEDMKTIDSLNRNFRYSQMAFALDHPDYPFLEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 132/304 (43%)
Tas 11..290 CDD:223739 125/287 (44%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 130/298 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.