DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c13

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_006254252.1 Gene:Akr1c13 / 361266 RGDID:1308232 Length:371 Species:Rattus norvegicus


Alignment Length:285 Identity:132/285 - (46%)
Similarity:171/285 - (60%) Gaps:8/285 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQN 102
            |||.|||||||||.|:.|.|:|.|:|.||..||:||||:.|||||||....|:.|:.|..|:|:|
  Rat    89 AIDAGYRHIDTAYAYQIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKN 153

  Fly   103 FGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNF 167
            ..|.|.|||:||:|.. :..|||: .|.|.||:..|:.:|:.|||..:||..:.||.||||||||
  Rat   154 LQLDYADLYIMHYPVP-MKSGDND-FPVDEKGKSLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNF 216

  Fly   168 NSEQLTRLL--ANCKIKPIHNQIECHPALNQKKLIALCKKNDIVVTAYCPLGRPNPAE----KTP 226
            |.:||.|||  ...|.||:.||:|||..|||.||:..||..|||:.||..||.....|    .:|
  Rat   217 NHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSP 281

  Fly   227 NYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDS 291
            ..:.|..:..:..|.|:|.|.:.||||::.|.:||.:|.....:.||.|:|||||..||...||.
  Rat   282 VLLNDPVLCDVAKKNKRSPALIALRYLVQRGVVPLAQSFKENEMRENLQVFDFQLSPEDMKTLDG 346

  Fly   292 YNTGERLIPMTHAIKSKNYPFNIEF 316
            .|...|.:..........|||:.|:
  Rat   347 LNKNFRYLSAEFLAGHPEYPFSEEY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 128/271 (47%)
Tas 11..290 CDD:223739 124/257 (48%)
Akr1c13XP_006254252.1 Tas 77..345 CDD:223739 124/257 (48%)
ARA1 89..353 CDD:223729 127/265 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.