DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and CG9436

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster


Alignment Length:316 Identity:164/316 - (51%)
Similarity:226/316 - (71%) Gaps:5/316 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRK 65
            |::..|.::.|||.::.::||||:.|...|...:|.||:||||||:|||:.||||.|||.|:..|
  Fly     1 MTNLAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEK 65

  Fly    66 IAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPT 130
            |||||:.||::.:||||....|:|..||.|||.:|.|.||:||||||||.|....:..|     :
  Fly    66 IAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHND-----S 125

  Fly   131 DAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALN 195
            :..|.:||.|:|||||||||||||:||||:|||:||||:.|..|:||||:|:|:.||:||||...
  Fly   126 NVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQ 190

  Fly   196 QKKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIP 260
            |::|....|::.:|:.|||||.||.||.:.|.::||...|.:..||.::|||:.||||:::|.:|
  Fly   191 QRQLREHAKRHGLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVP 255

  Fly   261 LPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            ||||||..||||||::|||:|..:|.|.::.|:||:|.:|.:.....|.||||.||
  Fly   256 LPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDEF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 156/297 (53%)
Tas 11..290 CDD:223739 150/278 (54%)
CG9436NP_610235.1 ARA1 3..298 CDD:223729 156/299 (52%)
Tas 6..282 CDD:223739 150/280 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472961
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Homologene 1 1.000 - - H134145
Inparanoid 1 1.050 209 1.000 Inparanoid score I815
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm51343
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1211.800

Return to query results.
Submit another query.