DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and gclm

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_009302077.1 Gene:gclm / 333974 ZFINID:ZDB-GENE-030131-5906 Length:274 Species:Danio rerio


Alignment Length:211 Identity:48/211 - (22%)
Similarity:83/211 - (39%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEV 136
            :||::.::.||:....:...:..|......:.|:..:|..::..|          .:|     |.
Zfish    84 EREELKVSVKLFLTEWDCSSIRSAVDMACLSLGVSQLDSVIIAPP----------SLP-----EG 133

  Fly   137 ELNDIDYLD-TWREMEKLVELGLTKSIGVSNFNSEQLTRLLANC-KIKPIHNQI---ECHPALNQ 196
            |...:.:|. .|:|:|.||:.....:||.|:.:...|.:|.... :|||..||:   .|  .:..
Zfish   134 ESQTLTHLQPLWQELESLVQSQKIAAIGTSDLDKTLLEQLYNWAQQIKPSSNQVNLASC--CVMP 196

  Fly   197 KKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQV--VLRYLIEI--- 256
            ..|.|..|:.||.:     |...:|.|......:...||....:.:....::  ||||.|.:   
Zfish   197 PDLTAFAKEFDIQL-----LTHSDPKELISAAGFQEAVQGSSQELQVDDWRLEWVLRYSIIVKSR 256

  Fly   257 ------GTIPLPKSSN 266
                  |.|...|.||
Zfish   257 GIIKAKGYIVHAKKSN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 48/211 (23%)
Tas 11..290 CDD:223739 48/211 (23%)
gclmXP_009302077.1 Aldo_ket_red <85..255 CDD:294321 43/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.