DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and zgc:56622

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005169977.1 Gene:zgc:56622 / 326033 ZFINID:ZDB-GENE-030131-4758 Length:324 Species:Danio rerio


Alignment Length:315 Identity:138/315 - (43%)
Similarity:183/315 - (58%) Gaps:12/315 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKHNNGTQIQSIGLGTY--TSLGGD-CERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEG 69
            ::.|:||.:..:||||:  .|.|.| |:||...||..||||||||:.|.||.:||.|:|.||.:|
Zfish    11 IELNDGTFMPLLGLGTWKPESTGPDMCQRACEAAIAAGYRHIDTAFCYRNEVDVGMAIQNKIQQG 75

  Fly    70 VIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKG 134
            :|:|:|:.|.:|||...|.|:.:.....|:|.:..|.|:|.||:|:|......|| |:.| :..|
Zfish    76 IIRRQDMFIVSKLWGTHHAPEDIPVCFNKSLSDLQLDYLDQYLVHFPVGLKKVGD-ELFP-ERDG 138

  Fly   135 EVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKL 199
            ::...||||:|.||.||.|...|..||||||||..||:.|||:..||.|..||:|.||.|.|..|
Zfish   139 KILTTDIDYVDVWRGMEALKATGKVKSIGVSNFTMEQIDRLLSVAKIPPAVNQVELHPYLVQSDL 203

  Fly   200 IALCKKNDIVVTAYCPLGRP-NPAE-----KTP-NYIYDAKVQAIGDKYKKSTAQVVLRYLIEIG 257
            |..||..:|.:||:.|.|.| .|.|     |.| ..:.|..|..:..|::::.|||:|||.|:..
Zfish   204 IDYCKSKNIALTAHSPFGSPGRPLEFQTGDKDPMGLLEDPVVVDVARKHRRTPAQVLLRYHIQQD 268

  Fly   258 TIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPF 312
            ...:|||..|..|.||.:||||.||.||...|.|.|.|.|...:|.......|||
Zfish   269 IAVIPKSVKPHHILENTKIFDFTLDEEDMNALKSLNRGWRACIITELEAHYFYPF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 135/305 (44%)
Tas 11..290 CDD:223739 129/288 (45%)
zgc:56622XP_005169977.1 ARA1 10..308 CDD:223729 133/298 (45%)
Tas 22..300 CDD:223739 126/279 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.