DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1b8

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_775159.1 Gene:Akr1b8 / 286921 RGDID:708475 Length:316 Species:Rattus norvegicus


Alignment Length:315 Identity:135/315 - (42%)
Similarity:195/315 - (61%) Gaps:7/315 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVI 71
            :|:.:...::..:||||:.|:....:.|...|||.||||||.||.|.||||||.|:|.||.|..:
  Rat     4 FVELSTKAKMPIVGLGTWKSMPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAV 68

  Fly    72 KREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEV 136
            :|||:.|.:|||....|.|.::.|.:|||.:..|.|:||||:|||..  ::...|:.|.|.:|.|
  Rat    69 RREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQG--FQAGKELFPKDEQGNV 131

  Fly   137 ELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKL 199
            ..:...:|:.|..||:||:.||.|::||||||..|:.|||  ...|.||:.||:||||.|.|:||
  Rat   132 LPSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKL 196

  Fly   200 IALCKKNDIVVTAYCPLG---RPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPL 261
            |..|....||||||.|||   ||......|:.:.|.|::.|..|:||:||||::|:.|:...:.:
  Rat   197 IQYCHSKGIVVTAYSPLGSPDRPRAKPDDPSLLQDPKIKEIAAKHKKTTAQVLIRFHIQRNVVVI 261

  Fly   262 PKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            |||..|.||:||.|:|||||..::.|.:.|:|...|...:...:..:.:|::.|:
  Rat   262 PKSVTPARIQENIQVFDFQLSDQEMATILSFNRNWRACLLPETVNMEEFPYDAEY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 133/301 (44%)
Tas 11..290 CDD:223739 129/283 (46%)
Akr1b8NP_775159.1 ARA1 1..297 CDD:223729 132/294 (45%)
Tas 16..289 CDD:223739 129/274 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.