DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c13

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_006516545.1 Gene:Akr1c13 / 27384 MGIID:1351662 Length:324 Species:Mus musculus


Alignment Length:317 Identity:134/317 - (42%)
Similarity:183/317 - (57%) Gaps:15/317 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKHNNGTQ--IQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGV 70
            |.|.:|.:  :..|.:....||...|     .|:||||||:||||.|:.|.|:|.|:|.||..||
Mouse    15 VNHYDGEKEDLVKINVPKSKSLEAAC-----LALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGV 74

  Fly    71 IKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGE 135
            :||||:.|||||||....|:.|:.|..|:|:...|.|||||:||:|.. :..|||: .|.:.:|:
Mouse    75 VKREDLFITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVP-MKSGDND-FPVNEQGK 137

  Fly   136 VELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKK 198
            ..|:.:|:.|||..:|:..:.||.|||||||||..||.|:|  ...|.||:.||:|||..|||:|
Mouse   138 SLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRK 202

  Fly   199 LIALCKKNDIVVTAYCPLGRPNPAE----KTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTI 259
            |:..|:..|||:.||..||.....|    .:|..:.|..:..:..|.|:|.|.:.|||||:.|.:
Mouse   203 LLDYCESKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIV 267

  Fly   260 PLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            ||.:|.....:.||.|:|.|||..||...||..|...|.:|....:....|||..|:
Mouse   268 PLAQSFKENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEFLVDHPEYPFVEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 130/303 (43%)
Tas 11..290 CDD:223739 123/286 (43%)
Akr1c13XP_006516545.1 AKR_AKR1C1-35 30..309 CDD:381334 125/285 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.