Sequence 1: | NP_647840.1 | Gene: | CG10863 / 38463 | FlyBaseID: | FBgn0027552 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016856545.1 | Gene: | GCLM / 2730 | HGNCID: | 4312 | Length: | 275 | Species: | Homo sapiens |
Alignment Length: | 216 | Identity: | 43/216 - (19%) |
---|---|---|---|
Similarity: | 78/216 - (36%) | Gaps: | 63/216 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 KREDIHITTKLW-----CHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTD 131
Fly 132 AKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQI---ECHPA 193
Fly 194 LNQKKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAI--------------------- 237
Fly 238 ---------GDKYKKSTAQVV 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10863 | NP_647840.1 | ARA1 | 6..304 | CDD:223729 | 43/216 (20%) |
Tas | 11..290 | CDD:223739 | 43/216 (20%) | ||
GCLM | XP_016856545.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0656 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |