DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and GCLM

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_016856545.1 Gene:GCLM / 2730 HGNCID:4312 Length:275 Species:Homo sapiens


Alignment Length:216 Identity:43/216 - (19%)
Similarity:78/216 - (36%) Gaps:63/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KREDIHITTKLW-----CHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTD 131
            :||::.::.||:     ........|:.||    ...|:..:|..::..|            |.:
Human    85 EREEMKVSAKLFIVESNSSSSTRSAVDMAC----SVLGVAQLDSVIIASP------------PIE 133

  Fly   132 AKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQI---ECHPA 193
            ....:.|..:.  ..|.|:|.||:.....:||.|:.:..||.:|....::||..||:   .|  .
Human   134 DGVNLSLEHLQ--PYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASC--C 194

  Fly   194 LNQKKLIALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAI--------------------- 237
            :....|.|..|:.||.:     |...:|.|...:::..|.::.:                     
Human   195 VMPPDLTAFAKQFDIQL-----LTHNDPKETGFHHVTQAGLEFLDSSNSPTSASQGAGILGMSHC 254

  Fly   238 ---------GDKYKKSTAQVV 249
                     ||||.:..|.|:
Human   255 AWTKGYFIQGDKYLEKVAHVI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 43/216 (20%)
Tas 11..290 CDD:223739 43/216 (20%)
GCLMXP_016856545.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.