DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and SPAC26F1.07

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_594888.1 Gene:SPAC26F1.07 / 2542088 PomBaseID:SPAC26F1.07 Length:321 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:111/289 - (38%)
Similarity:158/289 - (54%) Gaps:19/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKREDI 76
            :|::|..:||||:.|.....:.|...|:..||||||.|..|.||:|||..::    |..:.|:||
pombe    20 DGSKIPGLGLGTWRSEPNQTKNAVKTALQYGYRHIDAAAIYGNEDEVGDGIK----ESGVPRKDI 80

  Fly    77 HITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEV--ELN 139
            .:|:||||:.|.|:.|..|..|||::..|.|:|.||:|||.|  ::...:..|.|..|.:  |.|
pombe    81 WVTSKLWCNAHAPEAVPKALEKTLKDLKLDYLDEYLIHWPVS--FKTGEDKFPKDKDGNLIYEKN 143

  Fly   140 DIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALCK 204
            .|:  :||:.||||:|.|..:.||:||||...|.|:|...|:||..:|:|.||.|.|.:.:...|
pombe   144 PIE--ETWKAMEKLLETGKVRHIGLSNFNDTNLERILKVAKVKPAVHQMELHPFLPQTEFVEKHK 206

  Fly   205 KNDIVVTAYCPLGRPNP--AEKTPNYIYDAKVQAIGDKYKKST--AQVVLRYLIEIGTIPLPKSS 265
            |..|.||||.|.|..|.  ..|.|..|....:|.|.....:..  |.:.:.:.|..||..:|||.
pombe   207 KLGIHVTAYSPFGNQNTIYESKIPKLIEHETIQKIAKSKGEGVTGATIAVSWAITRGTSVIPKSV 271

  Fly   266 NPKRIEENFQIFDFQLDAEDHAILDSYNT 294
            |.:||:.||:.  ..|..||   :|..|:
pombe   272 NEQRIKSNFKY--IPLTKED---MDEINS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 111/289 (38%)
Tas 11..290 CDD:223739 109/283 (39%)
SPAC26F1.07NP_594888.1 ARA1 15..302 CDD:223729 111/289 (38%)
Tas 21..303 CDD:223739 111/288 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 243 1.000 Domainoid score I435
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I768
OMA 1 1.010 - - QHG53635
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9270
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.