DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and yak3

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_594498.1 Gene:yak3 / 2541648 PomBaseID:SPAC1F7.12 Length:340 Species:Schizosaccharomyces pombe


Alignment Length:344 Identity:82/344 - (23%)
Similarity:140/344 - (40%) Gaps:81/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPYVKHNNGTQIQSIG---LGTYTSLGGDCERAT----LHAIDVGYRHIDTAYFY---ENENEVG 59
            ||..|..|.| :.:||   :|.:...|...|.|.    .||.|:|....|::..|   .||..:|
pombe     3 IPTRKIGNDT-VPAIGFGCMGLHAMYGPSSEEANQAVLTHAADLGCTFWDSSDMYGFGANEECIG 66

  Fly    60 AAVQRKIAEGVIKREDIHITTKLWCH----------FHEPKRVEYACRKTLQNFGLQYVDLYLMH 114
            ...::     ..:|::|.:.||....          .:||..:|.|...:|:..|:..:|||   
pombe    67 RWFKQ-----TGRRKEIFLATKFGYEKNPETGELSLNNEPDYIEKALDLSLKRLGIDCIDLY--- 123

  Fly   115 WPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANC 179
                ||:|         ..||..:..|     ...::|.||.|..:.||:|..::..:.|..|..
pombe   124 ----YVHR---------FSGETPIEKI-----MGALKKCVEAGKIRYIGLSECSANTIRRAAAVY 170

  Fly   180 KIKPIHNQIECHP-ALNQKK----LIALCKKNDIVVTAYCPLGR-------PNPAE--------K 224
            .:..:  |:|..| :|..::    ::..|::|:|.:..|.||||       .:|.:        |
pombe   171 PVSAV--QVEYSPFSLEIERPEIGVMKACRENNITIVCYAPLGRGFLTGAYKSPDDFPEGDFRRK 233

  Fly   225 TPNYIYD---------AKVQAIGDKYKKSTAQVVLRYLIEIG--TIPLPKSSNPKRIEENFQIFD 278
            .|.|..:         .|::.|......:..|:.|.:|:..|  .:|:|.:...|.:||||....
pombe   234 APRYQKENFYKNLELVTKIEKIATANNITPGQLSLAWLLAQGDDILPIPGTKRVKYLEENFGALK 298

  Fly   279 FQL-DAEDHAILDSYNTGE 296
            .:| ||....|.::.:..|
pombe   299 VKLSDATVKEIREACDNAE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 81/343 (24%)
Tas 11..290 CDD:223739 78/330 (24%)
yak3NP_594498.1 Tas 3..320 CDD:223739 82/344 (24%)
Aldo_ket_red 5..312 CDD:119408 79/335 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.