DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and SPBC215.11c

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_596688.1 Gene:SPBC215.11c / 2540698 PomBaseID:SPBC215.11c Length:306 Species:Schizosaccharomyces pombe


Alignment Length:277 Identity:58/277 - (20%)
Similarity:109/277 - (39%) Gaps:49/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ATLHAI-DVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKREDIHITTK---------LWCHFHE 88
            |||..: ::....||||..|..|     ..:..:.|.:...:.:.|.||         .|.....
pombe    52 ATLKRLPELNINFIDTADSYGPE-----VSENLLREALYPYKGLIIATKGGLVRTGPNEWHPCGA 111

  Fly    89 PKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKL 153
            ||.:......:::..|::.:||:.:|              ..|.|       :...|.:.|:..:
pombe   112 PKFLRQEVLMSMRRLGVKQIDLWQLH--------------RIDPK-------VPRKDQFSEIAAM 155

  Fly   154 VELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQK--KLIALCKKNDIVVTAYCPL 216
            .:.||.:.:|:|....:.:........:..:.|...   .:|:|  |::..|::..|....:.||
pombe   156 KKEGLIRHVGLSEVTVDDIKEAEQYFPVVSVQNLFN---LVNRKNEKVLEYCEQKGIAFIPWYPL 217

  Fly   217 GRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTI--PLPKSSNPKRIEENFQIFDF 279
            .  :.|...|..|.|    |:.....:||:|:.|.::::...:  |:|.:|....:|||.:....
pombe   218 A--SGALAKPGTILD----AVSKDLDRSTSQIALSWVLQRSPVMLPIPGTSKVDHLEENVKAAGI 276

  Fly   280 QLDAEDHAILDSYNTGE 296
            ||.:|..|.||.....|
pombe   277 QLSSEVFAKLDEEGKSE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 58/277 (21%)
Tas 11..290 CDD:223739 55/269 (20%)
SPBC215.11cNP_596688.1 Aldo_ket_red 11..287 CDD:294321 55/269 (20%)
Tas 16..288 CDD:223739 56/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.