DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and SPCC965.06

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_588516.1 Gene:SPCC965.06 / 2539573 PomBaseID:SPCC965.06 Length:344 Species:Schizosaccharomyces pombe


Alignment Length:329 Identity:68/329 - (20%)
Similarity:118/329 - (35%) Gaps:93/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NGTQIQSIGLG---TYTSLGGDCE---RATLHAIDVGYRHIDTAYFYENENE---VGAAVQRKIA 67
            :|.::.:..||   ||.:.|.|.|   .....|.|:|....|||..|.|.|.   :|.|::    
pombe    21 SGLKVSAFSLGGWLTYGNEGYDVEHTKNCLKQAWDLGINTFDTAEIYSNGNSETVMGKAIK---- 81

  Fly    68 EGVIKREDIHITTKLWCHFH-----------EPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVY 121
            |....|.:..||||::  |.           ..|.:......:|:..||.|||:.:.|.|     
pombe    82 ELGWDRSEYVITTKVF--FGAGTKLPNTTGLSRKHIIEGLNASLKRLGLPYVDVIMAHRP----- 139

  Fly   122 RGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSN---FNSEQLTRLLANCK-IK 182
               :..:|.:             :..|...:|::.|.....|.|.   |..|....:..... |.
pombe   140 ---DPSVPME-------------EVVRAFTQLIQDGKAFYWGTSEWSAFEIEHAHHIATKYNLIA 188

  Fly   183 PIHNQIECHPALN-------QKKLIALCKKNDIVVTAYCPL-----------GRPNPAEKTPNYI 229
            |:.:|    |..|       :|.|:.|.:......|.:.||           |.|..:..:..:.
pombe   189 PVADQ----PQYNYLTRDHFEKDLLPLQQIYGYGATVWSPLKSGILTGKYNDGIPEGSRLSTTFT 249

  Fly   230 YDA----------------KVQAIGDKYKKSTAQVVLRYLIE---IGTIPLPKSSNPKRIEENFQ 275
            ..|                ::..|.::...:.:|:.|.:.::   :.|..| .:|.|::|.||.:
pombe   250 SLAGQLQTPEGKTQLDQVRQISKIAEQIGATPSQLALAWTLKNPYVSTTIL-GASKPEQIVENVK 313

  Fly   276 IFDF 279
            ..:|
pombe   314 AVEF 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 68/329 (21%)
Tas 11..290 CDD:223739 68/329 (21%)
SPCC965.06NP_588516.1 Kv_beta 15..333 CDD:213602 68/329 (21%)
Aldo_ket_red 15..332 CDD:119408 68/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.