DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AKR1B1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001619.1 Gene:AKR1B1 / 231 HGNCID:381 Length:316 Species:Homo sapiens


Alignment Length:311 Identity:146/311 - (46%)
Similarity:201/311 - (64%) Gaps:7/311 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKRED 75
            |||.::..:||||:.|..|....|...||||||||||.|:.|:||||||.|:|.|:.|.|:|||:
Human     8 NNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREE 72

  Fly    76 IHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELND 140
            :.|.:||||.:||...|:.||:|||.:..|.|:||||:|||..  ::...|..|.|..|.|..:|
Human    73 LFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTG--FKPGKEFFPLDESGNVVPSD 135

  Fly   141 IDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKLIALC 203
            .:.||||..||:||:.||.|:||:||||..|:..:|  ...|.||..|||||||.|.|:|||..|
Human   136 TNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC 200

  Fly   204 KKNDIVVTAYCPLG---RPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSS 265
            :...||||||.|||   ||....:.|:.:.|.:::||..|:.|:||||::|:.::...:.:|||.
Human   201 QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSV 265

  Fly   266 NPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            .|:||.|||::|||:|.::|...|.|||...|:..:......|:|||:.||
Human   266 TPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 140/297 (47%)
Tas 11..290 CDD:223739 135/283 (48%)
AKR1B1NP_001619.1 AKR_AKR1B1-19 10..316 CDD:381333 142/307 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.