DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1d1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_017176967.1 Gene:Akr1d1 / 208665 MGIID:2384785 Length:328 Species:Mus musculus


Alignment Length:302 Identity:122/302 - (40%)
Similarity:172/302 - (56%) Gaps:15/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTS---LGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIK 72
            ::|..|..||||||:.   :.|....|...|||.||||||.||.|.||:|||.|::.|||||.:|
Mouse    31 SDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVK 95

  Fly    73 REDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVE 137
            ||:|....|||...|.|..|..|..:||:...|.|:|||::..|.:  ::...|:.|.|..|.:.
Mouse    96 REEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMA--FKPGKEIYPRDENGRII 158

  Fly   138 LNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKLI 200
            .:..:...||..:|...:.||.||:||||||..||..:|  ...|.||:.||:||||...|.||:
Mouse   159 YDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLL 223

  Fly   201 ALCKKNDIVVTAYCPLGR-PNPA---EKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPL 261
            ..|:::|||:.|:.|||. .||:   ..:|..:.|..:.::|.||.|:.||:|||:.|:.|.:.:
Mouse   224 KFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVI 288

  Fly   262 PKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTH 303
            |||..|:||:||||:....|....|.:    ..|...:|..|
Mouse   289 PKSFTPERIKENFQVQCAPLPPSPHLL----RGGLLEVPTKH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 122/302 (40%)
Tas 11..290 CDD:223739 119/287 (41%)
Akr1d1XP_017176967.1 AKR_SF 33..303 CDD:382030 116/271 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.