DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c14

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_612556.1 Gene:Akr1c14 / 191574 RGDID:708361 Length:322 Species:Rattus norvegicus


Alignment Length:314 Identity:135/314 - (42%)
Similarity:182/314 - (57%) Gaps:11/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTS---LGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIK 72
            |:|..|..:|.||...   ...:..:||..|||.|:||.|:||.||.|.|||.|::.||.:|.:|
  Rat    11 NDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVK 75

  Fly    73 REDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVE 137
            ||||..|:|||..||.|:.|.....|||::..|.|||||::|:|.: :..|| ...|.|..|::.
  Rat    76 REDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMA-LQPGD-IFFPRDEHGKLL 138

  Fly   138 LNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKLI 200
            ...:|..|||..|||..:.||.|||||||||..||.|:|  ...|.||:.||:|||..|||.|::
  Rat   139 FETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKML 203

  Fly   201 ALCKKNDIVVTAYCPLGRPNPA----EKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPL 261
            ..||..||::.:||.||.....    :|:|..:.|..:.||..|||::.|.|.|||.::.|.:||
  Rat   204 DYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPL 268

  Fly   262 PKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIE 315
            .:|.|.|||:|..|:|:|||.:||...||..|...|.....:.....|:||..|
  Rat   269 IRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFDDHPNHPFTDE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 131/301 (44%)
Tas 11..290 CDD:223739 127/287 (44%)
Akr1c14NP_612556.1 AKR_AKR1C1-35 7..308 CDD:381334 131/298 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.