DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and C01G5.5

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_500993.1 Gene:C01G5.5 / 182074 WormBaseID:WBGene00015307 Length:287 Species:Caenorhabditis elegans


Alignment Length:289 Identity:94/289 - (32%)
Similarity:148/289 - (51%) Gaps:22/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKR 73
            |..||.:|..:.||||.:.|.....|...|:.||||..|||.:||||.::|.|::..:....|..
 Worm     3 KLKNGQEIPKLALGTYEAKGDQLFAAVDEALKVGYRSFDTAKYYENEKDLGLALKTLLPRHNICS 67

  Fly    74 EDIHITTKLWCHFHEPKRVEYACRK----TLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKG 134
            |||::|:|::.  :..|......||    :|:....:|:||.|:|:|           .|.|.:.
 Worm    68 EDIYLTSKVFP--YSSKNAAELIRKDVNESLELLDRKYLDLVLVHYP-----------RPLDTED 119

  Fly   135 EVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKL 199
            ..|.|.:...|||..:|||...|..:||||||:....:..:.:...|:|..||||.||...:|.|
 Worm   120 LNENNKMYRKDTWIALEKLHAEGKIRSIGVSNYEPHHIEEMRSYITIEPQVNQIEYHPHFQRKVL 184

  Fly   200 IALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKS 264
            .|.|.||:|:..|:.||||.|   ||  .:.|:.::.|...:|.:.|.|:|.::::.....:.||
 Worm   185 RAYCNKNEILFQAFSPLGRGN---KT--LLGDSTMERIALCHKTTVANVILAWIMKGKYGVVAKS 244

  Fly   265 SNPKRIEENFQIFDFQLDAEDHAILDSYN 293
            ..|.|:.||:.....:|..::...::..|
 Worm   245 VTPSRVAENYTSLSLELSDDEFEKINGLN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 94/289 (33%)
Tas 11..290 CDD:223739 92/282 (33%)
C01G5.5NP_500993.1 AKR_AKR1-5-like 10..270 CDD:381297 90/277 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166050
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.