DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and ZC443.1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_506205.1 Gene:ZC443.1 / 179756 WormBaseID:WBGene00013896 Length:320 Species:Caenorhabditis elegans


Alignment Length:329 Identity:133/329 - (40%)
Similarity:188/329 - (57%) Gaps:30/329 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRK 65
            ||||:|....:||..:.||||||:...|.:.:....:|:..||||||||..|:||:::|.|:...
 Worm     1 MSSKVPIFTLSNGVLMPSIGLGTWQMTGEEGKTVIRNAVLAGYRHIDTATLYQNEHQIGDALAEL 65

  Fly    66 IAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPT 130
            .|||::|||||.||||.:||...|..||.|.|.:|:...|.||||||.|.|.|   ..|:....:
 Worm    66 FAEGILKREDIFITTKAFCHEVAPDVVEEALRNSLKRLRLDYVDLYLAHIPAS---TKDDGSFRS 127

  Fly   131 DAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIH-NQIECHPAL 194
            |.|.|         |.||..||:..|||||:|||||||..|:.|:: |.:..||| :|:|.|..|
 Worm   128 DVKVE---------DIWRGFEKVYGLGLTKAIGVSNFNESQIVRIM-NIQKVPIHASQLELHLYL 182

  Fly   195 NQKKLIALCKKNDIVVTAYCPLGRP--------------NPAEKTPNYIYDAKVQAIGDKYKKST 245
            .||....||||::|::|||..||.|              ...:.:.|.:.|..|:|:..||.|:.
 Worm   183 PQKAHRELCKKHNILITAYATLGSPGRMSVVGSNGRPLFESTQNSENEMNDKHVKALAQKYSKTP 247

  Fly   246 AQVVLRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSY--NTGERLIPMTHAIKSK 308
            ||::||..:|:|.|.:||::||:|::||..||||.:...:..:|:::  ...|||....:.....
 Worm   248 AQILLRATVEMGIIVIPKTTNPERMKENINIFDFNISNAEVNLLEAHERTKQERLFWWPNVADHP 312

  Fly   309 NYPF 312
            ..||
 Worm   313 EDPF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 127/314 (40%)
Tas 11..290 CDD:223739 122/293 (42%)
ZC443.1NP_506205.1 AKR_AKR1G1_CeAKR 5..303 CDD:381380 126/310 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm4839
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17100
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.