DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and exc-15

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001367925.1 Gene:exc-15 / 178844 WormBaseID:WBGene00020369 Length:333 Species:Caenorhabditis elegans


Alignment Length:310 Identity:118/310 - (38%)
Similarity:177/310 - (57%) Gaps:11/310 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSLGGDCER--ATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKR 73
            |.|.|:...||||: .:..:.|.  |...|:|.|||.||||:.|:||:.:|..:...|:.|.:||
 Worm     9 NTGAQLPLFGLGTW-QVKDEAELTVALRAALDAGYRLIDTAHLYQNEHIIGKVLHEYISSGKLKR 72

  Fly    74 EDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVEL 138
            |||.:|:||....|.|:.|.......|:...|:|:||||:|.|:.:.:: :....|....||:.:
 Worm    73 EDIFVTSKLPFTAHAPEDVPKCVESQLKALQLEYIDLYLIHCPFPFKHQ-EGSFAPLMENGELAV 136

  Fly   139 NDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALC 203
            .:|.::||||.:|||.:.|..|::|||||:..||..|....::||.:.|:|||....|::|.|||
 Worm   137 TEIAHIDTWRALEKLYKEGKLKALGVSNFSCNQLQALYDAAEVKPANQQVECHIYWPQQELRALC 201

  Fly   204 KKNDIVVTAYCPLGRPNPAEKTPNYIY-------DAKVQAIGDKYKKSTAQVVLRYLIEIGTIPL 261
            ||..:.||||.|||.|......|:.::       :..|:.:..||.|:.||:::|:|.:.|...:
 Worm   202 KKLGVTVTAYAPLGSPGRKAARPDGVWPEGDPLLEPIVKQLAAKYHKTAAQILIRHLTQHGISTI 266

  Fly   262 PKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYP 311
            |||.:|.||.||...|||:|..||...|:|..|..||.....|:|...:|
 Worm   267 PKSVSPDRIVENISTFDFKLSDEDMHTLNSIETRTRLFIADFAVKHPFFP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 115/301 (38%)
Tas 11..290 CDD:223739 110/287 (38%)
exc-15NP_001367925.1 AKR_AKR1G1_CeAKR 3..306 CDD:381380 115/298 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.