DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Y39G8B.2

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_496926.1 Gene:Y39G8B.2 / 175048 WormBaseID:WBGene00012723 Length:339 Species:Caenorhabditis elegans


Alignment Length:324 Identity:97/324 - (29%)
Similarity:175/324 - (54%) Gaps:20/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKRED 75
            |:|.::..||.||:.............|::.||||||:|..::|:.||.|.::.......::||:
 Worm    10 NSGYEMPVIGYGTWQLPKNLAAERVRDALEAGYRHIDSALSFKNQEEVAAGIKDWCKIRKVRREE 74

  Fly    76 IHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVY---RGDNEMMPTDAKGEVE 137
            :.:::|:|..:|...|......:.|:.|...|:||.::|||:.:..   .|:..:.|..|.|::.
 Worm    75 LFLSSKIWNTYHSRNRCMQQIDEMLEIFETTYMDLIVIHWPFGWAEDEPPGERGLWPRGANGKMR 139

  Fly   138 LNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIAL 202
            .:|:|||:||:.:|.....|..:|||::|||..|:.::.....|||...|:|.:|.|:|:::...
 Worm   140 YSDVDYLETWKALEDAHRSGKIRSIGLANFNIGQVEQVWTKGLIKPAVLQVEMNPFLDQEEIRQF 204

  Fly   203 CKKNDIVVTAYCPLGRPNPA----EKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPK 263
            |::..|::||:...|.|..|    .:.||.:|:..:|:|...:.||..||::|:.|::.|..|.|
 Worm   205 CREKGIILTAFMLTGNPGSALYRKHEDPNLLYNETLQSIAKGHGKSVVQVLVRWAIDLRTTALVK 269

  Fly   264 SSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLI------------PMTHAIKSKNYPFNIE 315
            ||..|||.:|..||.|:|.:::.|.:.:.|...|::            |..| ::.:..|..:|
 Worm   270 SSESKRIRQNINIFKFRLTSQEIARIKALNIDFRILNPLLGNYDHPYFPWPH-VQEEQLPQKVE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 94/311 (30%)
Tas 11..290 CDD:223739 91/285 (32%)
Y39G8B.2NP_496926.1 AKR_AKR1-5-like 15..295 CDD:381297 89/279 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8417
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.