DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and E01A2.1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001367719.1 Gene:E01A2.1 / 171998 WormBaseID:WBGene00017084 Length:290 Species:Caenorhabditis elegans


Alignment Length:220 Identity:47/220 - (21%)
Similarity:89/220 - (40%) Gaps:48/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RATLHAIDV-GYRHIDTAYFYENENEVGAAVQRKIAEGVI---------------------KRED 75
            |..||..:| ||..:....|..:..|:.|.:..:::...|                     :|::
 Worm    30 RFRLHTGNVNGYTQLKVRRFETSAEELAACLDLQLSSNPIADDFKENSCLLLCDNDHIDNYERDE 94

  Fly    76 IHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELND 140
            |.||.|::....:.::::.|.....:....:.:::.::.:|         |:...|.:.|.:.| 
 Worm    95 IKITMKVFLSAWDVQQIDQAVTSLKEQLKTKDIEVLILSFP---------ELDLIDGESEEDEN- 149

  Fly   141 IDYLDTWRE--------MEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALN-Q 196
                :.|.|        ||||||.....|||||:|::.||..::.:..:||..|.:....... .
 Worm   150 ----NRWFEKVKPLYTYMEKLVETSEIASIGVSDFSARQLKTIIDHFDVKPSINHVRLDGCCQVP 210

  Fly   197 KKLIALCKKNDIVVTAYCPLGRPNP 221
            .:|.||...||:.:..:   ..|.|
 Worm   211 PELQALANDNDVQLLVH---NDPTP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 47/220 (21%)
Tas 11..290 CDD:223739 47/220 (21%)
E01A2.1NP_001367719.1 AKR_SF <92..>224 CDD:412396 35/145 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.