DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c3

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_612519.1 Gene:Akr1c3 / 171516 RGDID:708428 Length:323 Species:Rattus norvegicus


Alignment Length:325 Identity:142/325 - (43%)
Similarity:195/325 - (60%) Gaps:11/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYT---SLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAV 62
            |:|||..::.|:|..|..:|.|||.   :|......:|..|||||:||||.::.|:||.|:|.|:
  Rat     1 MNSKIQKMELNDGHSIPVLGFGTYATEENLRKKSMESTKIAIDVGFRHIDCSHLYQNEEEIGQAI 65

  Fly    63 QRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEM 127
            ..||.:|.:|||||..|:|||...|.|:.|..:...:|:...|.||||||:|:|.| :..|| |:
  Rat    66 VSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVS-LKPGD-EL 128

  Fly   128 MPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIEC 190
            :|.|..|.:.|:.:|..|||..|||..:.||.|||||||||..||.::|  ...|.:|:.||:||
  Rat   129 LPQDEHGNLILDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQVEC 193

  Fly   191 HPALNQKKLIALCKKNDIVVTAYCPLGRPNPA----EKTPNYIYDAKVQAIGDKYKKSTAQVVLR 251
            |..|||.||:|.||.||||:.||..||.....    |.||..:.|..:..:..|||::.|.:.||
  Rat   194 HLYLNQSKLLAYCKMNDIVLVAYGALGTQRYKYCINEDTPVLLDDPILCTMAKKYKRTPALIALR 258

  Fly   252 YLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            |.:|.|.:.|.||.|.:||.||.|:|||||.::|..|||:.:...|..|........|:||:.|:
  Rat   259 YQLERGIVTLVKSFNEERIRENLQVFDFQLASDDMEILDNLDRNLRYFPANMFKAHPNFPFSDEY 323

  Fly   317  316
              Rat   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 134/306 (44%)
Tas 11..290 CDD:223739 130/287 (45%)
Akr1c3NP_612519.1 AKR_AKR1C1-35 6..308 CDD:381334 133/303 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.