DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Kcnab2

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_011248499.1 Gene:Kcnab2 / 16498 MGIID:109239 Length:414 Species:Mus musculus


Alignment Length:343 Identity:75/343 - (21%)
Similarity:131/343 - (38%) Gaps:95/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSKIPYVKHNN----GTQIQSIGLGTYTSLGGD-----CERATLHAIDVGYRHIDTAYFYENENE 57
            |.|.|.:|:.|    |.::..:||||:.:.||.     .|.....|.|.|....|||       |
Mouse    62 SLKQPGMKYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTA-------E 119

  Fly    58 VGAAVQRKIAEGVI------KREDIHITTKL-WCHFHEPKR------VEYACRKTLQNFGLQYVD 109
            |.||.:.::..|.|      :|..:.||||: |....|.:|      :....:.:|:...|:|||
Mouse   120 VYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVD 184

  Fly   110 LYLMHWPYSYVYRGDNEMMPTDAKGEVELND-----------IDYLDTWREMEKLVELGLTKSIG 163
            :...:.|              |....:|..|           |:  :|.|.|..::..|:....|
Mouse   185 VVFANRP--------------DPNTPMEAGDPFSSFKSRTFIIE--ETVRAMTHVINQGMAMYWG 233

  Fly   164 VSNFNSEQLTRLLANCK----IKPIHNQIECHPALNQK---KLIALCKKNDIVVTAYCPL----- 216
            .|.::|.::....:..:    |.||..|.|.|....:|   :|..|..|..:....:.||     
Mouse   234 TSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIV 298

  Fly   217 ------GRP---NPAEKTPNYIYD--------------AKVQAIGDKYKKSTAQVVLRYLIE--- 255
                  |.|   ..:.|...::.|              .::|||.::...:..|:.:.:.:.   
Mouse   299 SGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEG 363

  Fly   256 IGTIPLPKSSNPKRIEEN 273
            :.:: |..:||.:::.||
Mouse   364 VSSV-LLGASNAEQLMEN 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 73/339 (22%)
Tas 11..290 CDD:223739 71/334 (21%)
Kcnab2XP_011248499.1 Aldo_ket_red_shaker 69..394 CDD:381367 72/336 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.