DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Kcnab1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001344287.1 Gene:Kcnab1 / 16497 MGIID:109155 Length:419 Species:Mus musculus


Alignment Length:325 Identity:72/325 - (22%)
Similarity:120/325 - (36%) Gaps:91/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HNN----GTQIQSIGLGTYTSLGGD-----CERATLHAIDVGYRHIDTAYFYENENEVGAAVQRK 65
            |.|    |.::..:||||:.:.||.     .||....|.:.|....|||       ||.||.:.:
Mouse    91 HRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTA-------EVYAAGKAE 148

  Fly    66 IAEGVI------KREDIHITTKL-WCHFHEPKR------VEYACRKTLQNFGLQYVDLYLMHWPY 117
            :..|.|      :|..:.||||| |....|.:|      :....:.:||...|:|||:...:.| 
Mouse   149 VILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRP- 212

  Fly   118 SYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCK-- 180
                         |:...:|       :..|.|..::..|:....|.|.:::.::....:..:  
Mouse   213 -------------DSNTPME-------EIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQF 257

  Fly   181 --IKPIHNQIECHPALNQK---KLIALCKKNDIVVTAYCPL-----------GRPNPAEKTPNYI 229
              |.|:..|.|.|....:|   :|..|..|..:....:.||           |.|..:..:....
Mouse   258 NMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCY 322

  Fly   230 YDAKVQAIGDKYKKSTAQVVLRYLIEIG-----TIP----------------LPKSSNPKRIEEN 273
            ...|.:.:.::.:|.  |..|:.|..|.     |:|                |..||.|:::.||
Mouse   323 QWLKERIVSEEGRKQ--QNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIEN 385

  Fly   274  273
            Mouse   386  385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 72/325 (22%)
Tas 11..290 CDD:223739 71/324 (22%)
Kcnab1NP_001344287.1 Kv_beta 91..407 CDD:213602 72/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.