DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c20

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001298061.1 Gene:Akr1c20 / 116852 MGIID:2151104 Length:323 Species:Mus musculus


Alignment Length:327 Identity:133/327 - (40%)
Similarity:189/327 - (57%) Gaps:15/327 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYTSLGGDCER-----ATLHAIDVGYRHIDTAYFYENENEVGA 60
            |:||...|..|:|..|..:|.|  ||...:..|     ||..|||.|:||||.|..|:||.|||.
Mouse     1 MNSKQQTVLLNDGHFIPILGFG--TSAPQEVPRSKATEATKIAIDAGFRHIDCAAVYQNEKEVGL 63

  Fly    61 AVQRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDN 125
            |::.||.:|.:|||||..|:|:|..||.|:.|:....::|:...|.||||||:|:|.: :..|:|
Mouse    64 AIRSKIVDGTVKREDIFCTSKVWQTFHRPELVQVCLEQSLKQLQLDYVDLYLIHFPIA-MKPGEN 127

  Fly   126 EMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLA--NCKIKPIHNQI 188
             ..|.|..|:...:.:|..|||..|||..:.||.|||||.|||..||.::|:  ..|.||:.||:
Mouse   128 -YFPKDENGKFIYDAVDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQV 191

  Fly   189 ECHPALNQKKLIALCKKNDIVVTAYCPLGRPNPAE----KTPNYIYDAKVQAIGDKYKKSTAQVV 249
            ||||.|||:||:..|:..|||:.|:..||.....|    ..|..:.|..:.::..||.::.|.:.
Mouse   192 ECHPYLNQRKLLDFCRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIA 256

  Fly   250 LRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNI 314
            |||.::.|.:.|.||...|||:||.|:|:|||.:.|..:||..|...|.|..:.:....::||..
Mouse   257 LRYQVQRGVVVLAKSFIEKRIKENMQVFEFQLTSVDMKVLDGLNKNIRYIGSSISEDHPDFPFLD 321

  Fly   315 EF 316
            |:
Mouse   322 EY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 127/308 (41%)
Tas 11..290 CDD:223739 121/289 (42%)
Akr1c20NP_001298061.1 ARA1 5..317 CDD:223729 127/315 (40%)
Tas 16..297 CDD:223739 119/284 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.