DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1b3

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_033788.3 Gene:Akr1b3 / 11677 MGIID:1353494 Length:316 Species:Mus musculus


Alignment Length:314 Identity:148/314 - (47%)
Similarity:204/314 - (64%) Gaps:7/314 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVI 71
            :::.||||::.::||||:.|..|....|...|||:||||||.|..|:||.|||.|:|.|:.|.|:
Mouse     4 HLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVV 68

  Fly    72 KREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEV 136
            ||:|:.|.:||||.||:...|:.|.:|||.:..|.|:||||:|||..  ::...:..|.||.|.|
Mouse    69 KRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTG--FKPGPDYFPLDASGNV 131

  Fly   137 ELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKL 199
            ..:|.|::|||..||:||:.||.|:|||||||..|:.|:|  ...|.||..|||||||.|.|:||
Mouse   132 IPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKL 196

  Fly   200 IALCKKNDIVVTAYCPLG---RPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPL 261
            |..|....||||||.|||   ||....:.|:.:.|.:::||..||.|:||||::|:.|:...:.:
Mouse   197 IEYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVI 261

  Fly   262 PKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIE 315
            |||..|.||.||.::|||::.:||.|.|.|||...|:..:....|.|:|||:.|
Mouse   262 PKSVTPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 142/301 (47%)
Tas 11..290 CDD:223739 137/283 (48%)
Akr1b3NP_033788.3 ARA1 1..297 CDD:223729 141/294 (48%)
Tas 8..289 CDD:223739 137/282 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.