DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1b7

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_038962847.1 Gene:Akr1b7 / 116463 RGDID:620257 Length:329 Species:Rattus norvegicus


Alignment Length:293 Identity:125/293 - (42%)
Similarity:176/293 - (60%) Gaps:7/293 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKREDIHITTKLWCHFHEPKRVE 93
            |..:.|...|||.||||.|.||.|:||:|||.|:|.||.|..::|||:.|.:|||..|.|...::
  Rat    39 GQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMK 103

  Fly    94 YACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGL 158
            .|.:|||.:..|.|:||||:|||..  .:...|.:|.|::|:|.::...:||.|..||:||:.||
  Rat   104 EAFQKTLSDLKLDYLDLYLIHWPQG--LQAGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGL 166

  Fly   159 TKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQKKLIALCKKNDIVVTAYCPLG---R 218
            .|::||||||..|:.|||  ...|.||:.||:||||.|.|:|||..|....|.|.||.|||   |
  Rat   167 VKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDR 231

  Fly   219 PNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDA 283
            |....:.|..:...|::.|..|:||:.|||::|:.::.....:|||.....|:||.|:|||||..
  Rat   232 PYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSE 296

  Fly   284 EDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            ||.|.:.|.|...|...:......:::||:.|:
  Rat   297 EDMAAILSLNRNWRACGLFVTSDEEDFPFHEEY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 122/279 (44%)
Tas 11..290 CDD:223739 119/265 (45%)
Akr1b7XP_038962847.1 AKR_SF 35..329 CDD:412396 124/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.