DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and Akr1c18

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_598827.1 Gene:Akr1c18 / 105349 MGIID:2145420 Length:323 Species:Mus musculus


Alignment Length:325 Identity:140/325 - (43%)
Similarity:190/325 - (58%) Gaps:11/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKIPYVKHNNGTQIQSIGLGTYTS---LGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAV 62
            |:|||..::.|:|..|..:|.|||.:   |......:|..|||||:.|||.::.|:||.|:|.|:
Mouse     1 MNSKIQKIELNDGHSIPVLGFGTYATEEHLKKKSMESTKIAIDVGFCHIDCSHLYQNEEEIGQAI 65

  Fly    63 QRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEM 127
            ..||.:|.:|||||..|:|||...|.|:.|..:...:|:...|.||||||:|:|.|  .:..||:
Mouse    66 LSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVS--LKPGNEL 128

  Fly   128 MPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIEC 190
            :|.|..|.:..:.:|..|||..|||..:.||.|||||||||..||..:|  ...|.||:.||:||
Mouse   129 LPKDEHGNLIFDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVEC 193

  Fly   191 HPALNQKKLIALCKKNDIVVTAYCPLGRPNPA----EKTPNYIYDAKVQAIGDKYKKSTAQVVLR 251
            |..|||.||:|.||.||||:.||..||.....    |.||..:.|..:.|:..|||::.|.:.||
Mouse   194 HLYLNQSKLLAYCKMNDIVLVAYGALGTQRYKYCINEDTPVLLDDPVLCAMAKKYKRTPALIALR 258

  Fly   252 YLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPFNIEF 316
            |.::.|.:.|.||.|.:||.||.|:|||||.::|..|||..:...|..|........|:||..|:
Mouse   259 YQLDRGIVALAKSFNEERIRENMQVFDFQLASDDMKILDGLDRNLRYFPADMFKAHPNFPFFDEY 323

  Fly   317  316
            Mouse   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 132/306 (43%)
Tas 11..290 CDD:223739 128/287 (45%)
Akr1c18NP_598827.1 ARA1 7..310 CDD:223729 132/304 (43%)
Tas 15..297 CDD:223739 126/283 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.